PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g07110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 212aa    MW: 25127.4 Da    PI: 7.0634
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g07110genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-1956109457
                 -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 ++++++eq++ Le+ F  ++++ +e++ +LA++lgL+  qV vWFqNrRa++k+
  CA04g07110  56 KRKLSEEQVNLLERSFGDEHKLETERKDKLASELGLDPHQVAVWFQNRRARWKN 109
                 45899***********************************************95 PP

2HD-ZIP_I/II112.52.8e-3655145292
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kr+ls+eqv+lLE+sF  e+kLe+erK +la+eLgl+p+qvavWFqnrRAR+k+k+lE++y++Lk ++++   e+ rLe+ev +++e+l 
   CA04g07110  55 RKRKLSEEQVNLLERSFGDEHKLETERKDKLASELGLDPHQVAVWFQNRRARWKNKKLEEEYSKLKIQHETTIIEKYRLETEVLKMKEQLC 145
                  8**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.8E-1753114IPR001356Homeobox domain
CDDcd000861.97E-1455111No hitNo description
PROSITE profilePS5007116.45555110IPR001356Homeobox domain
PfamPF000461.4E-1656109IPR001356Homeobox domain
SuperFamilySSF466893.29E-1756117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-2057117IPR009057Homeodomain-like
PRINTSPR000311.6E-58190IPR000047Helix-turn-helix motif
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PRINTSPR000311.6E-590106IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MTDRKVDDQM ILISHQFYPH IYVQLTEDLQ EETVKPRRRK NKKREGNNNT SVVVRKRKLS  60
EEQVNLLERS FGDEHKLETE RKDKLASELG LDPHQVAVWF QNRRARWKNK KLEEEYSKLK  120
IQHETTIIEK YRLETEVLKM KEQLCQAEKQ IQRLLFERNC DISSNSPTSS IFSMEQPQFN  180
LGEFGMEGLL MDNNVFFVGD NQSTYATLWD N*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13539PRRRK
23644RRRKNKKRE
34157KKREGNNNTSVVVRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755155e-84HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571705.11e-157PREDICTED: homeobox-leucine zipper protein ATHB-40-like isoform X1
SwissprotQ9ZU702e-60ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4BFT31e-107K4BFT3_SOLLC; Uncharacterized protein
STRINGSolyc03g034110.2.11e-106(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.12e-53homeobox protein 40